SRBD1 Rabbit Polyclonal Antibody

SKU: orb577824

Description

Rabbit polyclonal antibody to SRBD1

Research Area

Molecular Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SRBD1
• Target: SRBD1
• Protein Sequence: Synthetic peptide located within the following region: MSSLPRRAKVQVQDVVLKDEFSSFSELSSASEEDDKEDSAWEPQKKVPRS
• Molecular Weight: 112kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FLJ10379

Rabbit Anti-SRBD1 antibody, Paraffin Embedded Tissue: Human Lung, cell Cellular Data: alveolar cell, Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

WB Suggested Anti-SRBD1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate. SRBD1 is supported by BioGPS gene expression data to be expressed in 721_B.

Quick Database Links

Gene Symbol

SRBD1

UniProt

Q8N5C6

RefSeq (Protein):NP_060549