SQSTM1 Rabbit Polyclonal Antibody

SKU: orb331462

Description

SQSTM1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SQSTM1. It is suitable for WB application. The immunogen for Anti-SQSTM1 antibody is: synthetic peptide directed towards the C-terminal region of Human SQSTM. This antibody reacts with Human samples and is predicted to react with Human. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SQSTM1 antibody is: synthetic peptide directed towards the C-terminal region of Human SQSTM
• Target: SQSTM1
• Protein Sequence: Synthetic peptide located within the following region: TQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGEL
• Molecular Weight: 48 kDa
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti p60 antibody, anti p62 antibody, anti A170 antibody, anti OSIL antibody, anti PDB3 antibody, anti ZIP3 antibody, anti p62B antibody, anti FTDALS3 antibody

Quick Database Links

Gene Symbol

SQSTM1

UniProt

Q13501