SPSB1 Rabbit Polyclonal Antibody

• Catalog Number: orb326606
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SPSB1
• Target: SPSB1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SPSB1
• Protein Sequence: Synthetic peptide located within the following region: RGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDL
• UniProt ID: Q96BD6
• MW: 31 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti SSB-1 antibody, anti SSB1 antibody
• Research Area: Protein Biochemistry
• Note: For research use only
• NCBI: NP_079382

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Positive control (+): Human Liver (LI), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/mL.

WB Suggested Anti-SPSB1 Antibody, Titration: 1.0 ug/mL, Positive Control: Fetal Lung.