You have no items in your shopping cart.
Cart summary
Item 1 of 1
SPRN Rabbit Polyclonal Antibody
Catalog Number: orb586094
| Catalog Number | orb586094 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SPRN |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPRN |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 10kDa |
| Target | SPRN |
| UniProt ID | Q5BIV9 |
| Protein Sequence | Synthetic peptide located within the following region: LLAAAFLCDSGAAKGGRGGARGSARGGVRGGARGASRVRVRPAQRYGAPG |
| NCBI | NP_001012526 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | SHO, SHADOO, bA108K14.1 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-SPRN Antibody, Titration: 1.0 ug/ml, Positive Control: ACHN Whole Cell.
- Item 1 of 3
SPATC1 Antibody (N-term) [orb1938849]
IHC-P, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl - Item 1 of 2
- Item 1 of 2
- Item 1 of 2
- Item 1 of 1
