SPON2 Rabbit Polyclonal Antibody

SKU: orb330680

Description

SPON2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SPON2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human SPON2. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPON2
• Target: SPON2
• Protein Sequence: Synthetic peptide located within the following region: GTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARV
• Molecular Weight: 36kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DIL-1 antibody, anti DIL1 antibody, anti M-spondin antibody, anti Mindin antibody, anti MINDIN antibody, anti M-SPONDIN antibody

Quick Database Links

Gene Symbol

SPON2

UniProt

Q9BUD6

RefSeq (Protein):NP_036577