SPINK6 monoclonal antibody (M04), clone 3C10

• Catalog Number: orb2290557
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant SPINK6.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: SPINK6 (AAH32003.1, 1 a.a. ~ 80 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MKLSGMFLLLSLALFCFLTGVFSQGGQVDCGEFQDTKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC
• Tested applications: ELISA, WB
• Clone Number: 3C10
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH32003.1

Detection limit for recombinant GST tagged SPINK6 is 0.03 ng/ml as a capture antibody.

Western Blot detection against Immunogen (35 KDa).