Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

SPI1 Rabbit Polyclonal Antibody

SKU: orb329975

Description

Rabbit polyclonal antibody to SPI1

Research Area

Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SPI1
TargetSPI1
Protein SequenceSynthetic peptide located within the following region: QKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAER
Molecular Weight31kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti OF antibody, anti PU.1 antibody, anti SFPI1 antibody, anti SPI-1 antibody, anti SPI-A antibody

Similar Products

  • alpha 1 Antitrypsin Rabbit Polyclonal Antibody [orb339609]

    IHC-P,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • alpha 1 Antitrypsin Rabbit Polyclonal Antibody [orb339610]

    IHC-P,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    500 μg, 100 μg
  • PU.1 rabbit pAb Antibody [orb766159]

    ELISA,  IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • AAT Rabbit Polyclonal Antibody [orb10017]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Mouse, Porcine

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
  • PU.1/SPI1/PU Rabbit Polyclonal Antibody [orb1097960]

    ELISA,  FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SPI1 Rabbit Polyclonal Antibody

Sample Tissue: Human RPMI 8226 Whole Cell, Antibody Dilution: 3 ug/mL.

SPI1 Rabbit Polyclonal Antibody

Positive control (+): U937 Cell Lysate (N31), Negative control (-): A549 Cell Lysate (N03), Antibody concentration: 3 ug/mL.

SPI1 Rabbit Polyclonal Antibody

WB Suggested Anti-SPI1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Muscle.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003111

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SPI1 Rabbit Polyclonal Antibody (orb329975)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry