SPATA24 Rabbit Polyclonal Antibody

• Catalog Number: orb582114
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SPATA24
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of human SPATA24
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 23kDa
• Target: SPATA24
• UniProt ID: Q86W54
• Protein Sequence: Synthetic peptide located within the following region: LQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQ
• NCBI: NP_919272
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: T6441, CCDC161
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-SPATA24 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.