Cart summary

You have no items in your shopping cart.

SP7 Rabbit Polyclonal Antibody

SKU: orb333702

Description

Rabbit polyclonal antibody to Sp7/Osterix

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SP7
TargetSP7
Protein SequenceSynthetic peptide located within the following region: MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSV
Molecular Weight45 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti MGC126598 antibody, anti Osterix antibody, anti Osx antibody, anti Sp 7 antibody, anti SP7 antibody, anti Sp7 transcription factor antibody, anti Transcription factor Sp7 antibody, anti Zinc finger protein osterix antibody

Similar Products

  • SP7/Osterix Rabbit Polyclonal Antibody [orb500983]

    ELISA,  WB

    Mouse

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • SP7 Rabbit Polyclonal Antibody [orb333700]

    IHC,  WB

    Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SP7 rabbit pAb Antibody [orb772153]

    ELISA,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Sp7/Osterix Rabbit Polyclonal Antibody [orb360768]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Sp7/Osterix Rabbit Polyclonal Antibody [orb11194]

    ELISA,  IHC-P,  WB

    Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SP7 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 43 kDa.

SP7 Rabbit Polyclonal Antibody

Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

SP7 Rabbit Polyclonal Antibody

Immunohistochemistry with Testis tissue at an antibody concentration of 5 ug/ml using anti-SP7 antibody (orb333702).

SP7 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

SP7 Rabbit Polyclonal Antibody

WB Suggested Anti-SP7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human kidney.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_690599

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SP7 Rabbit Polyclonal Antibody (orb333702)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry