SOX9 Rabbit Polyclonal Antibody

• Catalog Number: orb576483
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SOX9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Zebrafish
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SOX9
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: SOX9
• UniProt ID: P48436
• Protein Sequence: Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ
• NCBI: NP_000337
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CMD1, SRA1, CMPD1, SRXX2, SRXY10
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-SOX9 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.