SOX3 Rabbit Polyclonal Antibody

• Catalog Number: orb330002
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SOX3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Mouse, Porcine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SOX3
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 45kDa
• Target: SOX3
• UniProt ID: P41225
• Protein Sequence: Synthetic peptide located within the following region: MRPVRENSSGARSPRVPADLARSILISLPFPPDSLAHRPPSSAPTESQGL
• NCBI: NP_005625
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti PHP antibody, anti GHDX antibody, anti MRGH a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-SOX3 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate, SOX3 is supported by BioGPS gene expression data to be expressed in MCF7.