SOX14 Rabbit Polyclonal Antibody

SKU: orb575591

Description

SOX14 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of SOX14. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human SOX14. This antibody reacts with Human samples and is predicted to react with Bovine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Neuroscience, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SOX14
• Target: SOX14
• Protein Sequence: Synthetic peptide located within the following region: HTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTA
• Molecular Weight: 26kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

SOX28

Quick Database Links

Gene Symbol

SOX14

UniProt

O95416

RefSeq (Protein):NP_004180