You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292141 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant SOX10. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | SOX10 (NP_008872, 336 a.a. ~ 433 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR |
Tested applications | ELISA, IHC-P, WB |
Clone Number | 1E6 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_008872 |
Immunoperoxidase of monoclonal antibody to SOX10 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml]
Western Blot detection against Immunogen (36.52 KDa).