SOD2 Antibody

• Catalog Number: orb259619
• Category: Antibodies
• Description: SOD2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SOD2 (192-222aa QYKNVRPDYLKAIWNVINWENVTERYMACKK), different from the related mouse sequence by one amino acid, and from the related rat sequence by four amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, By HeatImmunocytochemistry, 0.5-1μg/mlWestern blot, 0.1-0.5μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 24722 MW
• UniProt ID: P04179
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Superoxide dismutase [Mn], mitochondrial;1.15.1.1;
• Note: For research use only
• Application notes: WB: The detection limit for SOD2 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of SOD2 using anti-SOD2 antibody.Lane 1:Human HepG2 cell;2:rat liver tissue;3:rat lung tissue;4:mouse liver tissue;5:mouse lung tissue.

IHC analysis of SOD2 using anti-SOD2 antibody. SOD2 was detected in paraffin-embedded section of human mammary cancer tissue.

IHC analysis of SOD2 using anti-SOD2 antibody.SOD2 was detected in immunocytochemical section of SMMC-7721 cell.

IHC analysis of SOD2 using anti-SOD2 antibody.SOD2 was detected in immunocytochemical section of A549 cell.