SNX27 Rabbit Polyclonal Antibody

• Catalog Number: orb586243
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SNX27
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SNX27
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 25kDa
• Target: SNX27
• UniProt ID: Q96L92
• Protein Sequence: Synthetic peptide located within the following region: EEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQRKMVMYL
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MRT1, MY014
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.0 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane.

Sample Type: Jurkat Whole cell lysates, Antibody dilution: 1.0 ug/ml. SNX27 is supported by BioGPS gene expression data to be expressed in Jurkat.

Positive control (+): Human Placenta (PL), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 1 ug/ml.