Sntg1 Rabbit Polyclonal Antibody

• Catalog Number: orb326182
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Sntg1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Human, Rabbit, Rat, Zebrafish
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 57kDa
• Target: Sntg1
• UniProt ID: Q925E1
• Protein Sequence: Synthetic peptide located within the following region: KLPVNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPG
• NCBI: NP_081947
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti 4933426D16Rik antibody, anti G1SYN antibody,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Sntg1 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Pancreas.