SNRP70 Rabbit Polyclonal Antibody

• Catalog Number: orb577519
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SNRP70
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNRP70
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 52kDa
• Target: SNRNP70
• UniProt ID: P08621
• Protein Sequence: Synthetic peptide located within the following region: PHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRS
• NCBI: NP_003080
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RPU1, Snp1, U1AP, U170K, U1RNP, RNPU1Z, SNRP70, U1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-SNRP70 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. SNRNP70 is supported by BioGPS gene expression data to be expressed in Jurkat.

WB Suggested Anti-SNRP70 antibody Titration: 1 ug/ml, Sample Type: HEK293.

WB Suggested Anti-SNRP70 antibody Titration: 1 ug/ml, Sample Type: Human Raji.