Smpd4 Rabbit Polyclonal Antibody

• Catalog Number: orb580034
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Smpd4
• Target: Smpd4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Smpd4
• Protein Sequence: Synthetic peptide located within the following region: LHSPAQPSLQALHAYQESFMPTEEHVLVVRLLLKHLHAFANSLKPDQASP
• UniProt ID: F1MAK9
• MW: 90kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RGD1310674
• Note: For research use only
• NCBI: NP_001161278

WB Suggested Anti-Smpd4 Antibody, Titration: 1.0 ug/ml, Positive Control: Rat Testis.