SMN1/2 Antibody

• Catalog Number: orb251581
• Category: Antibodies
• Description: SMN1/2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SMN1/2 (22-52aa RRGTGQSDDSDIWDDTALIKAYDKAVASFKH), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 31849 MW
• UniProt ID: Q16637
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Survival motor neuron protein;Component of gems 1;
• Note: For research use only
• Application notes: WB: The detection limit for SMN1/2 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

IHC(P) analysis of Mouse Brain Tissue using Anti-SMN1/2 Picoband antibody.

IHC(P) analysis of Rat Brain Tissue using Anti-SMN1/2 Picoband antibody.

IHC(P) analysis of Human Mammary Cancer Tissue using Anti-SMN1/2 Picoband antibody.

Flow Cytometry analysis of A431 cells using anti-SMN1/2 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Western blot analysis using Anti-SMN1/2 Picoband antibody.Lane 1:Rat Brain Tissue;2:Mouse Brain Tissue;3:Rat Liver Tissue;4:Mouse Liver Tissue;5:293T Cell;6:SMMC Cell;7:HEPG2 Cell;8:HELA Cell.

IF analysis of SMN1/2 using anti-SMN1/2 antibody. SMN1/2 was detected in immunocytochemical section of U20S cells.