SMN1/2 Antibody (monoclonal, 2B10)

• Catalog Number: orb421125
• Category: Antibodies
• Description: SMN1/2 Antibody (monoclonal, 2B10)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2B10
• Tested applications: ICC, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Mouse IgG1
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SMN1/2 (22-52aa RRGTGQSDDSDIWDDTALIKAYDKAVASFKH), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunocytochemistry, 0.5-1μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 39 kDa
• UniProt ID: Q16637
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Survival motor neuron protein; Component of gems 1
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of SMN1/2 using anti-SMN1/2 antibody.Lane 1:human HeLa cell;2:human placenta tissue;3:human SW620 cell;4:human PANC-1 cell;5:human HepG2 cell;6:human A549 cell;7:rat RH35 cell;8:mouse HEPA1-6 cell.

IHC analysis of SMN1/2 using anti-SMN1/2 antibody.SMN1/2 was detected in paraffin-embedded section of human mammary cancer tissue.

IHC analysis of SMN1/2 using anti-SMN1/2 antibody.SMN1/2 was detected in paraffin-embedded section of human mammary cancer tissue.

IHC analysis of SMN1/2 using anti-SMN1/2 antibody.SMN1/2 was detected in immunocytochemical section of A431 cell.