Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SMC1A Rabbit Polyclonal Antibody

SKU: orb576827

Description

SMC1A Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SMC1A. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human SMC1A. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human SMC1A
TargetSMC1A
Protein SequenceSynthetic peptide located within the following region: VISLKEEFYTKAESLIGVYPEQGDCVISKVLTFDLTKYPDANPNPNEQ
Molecular Weight143kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

SMC1, SMCB, CDLS2, DEE85, SB1.8, EIEE85, SMC1L1, DXS423E, SMC1alpha

Similar Products

  • Phospho-SMC1 (Ser360) Rabbit Polyclonal Antibody [orb6987]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Guinea pig, Human, Porcine, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • SMC1A Rabbit Polyclonal Antibody [orb631324]

    ELISA,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • SMC1A Rabbit Polyclonal Antibody [orb556631]

    IHC-P,  IP,  WB

    Human, Zebrafish

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SMC1A Rabbit Polyclonal Antibody [orb412523]

    IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl, 30 μl
  • SMC1A Antibody (N-term) [orb1936602]

    WB

    Mouse

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SMC1A Rabbit Polyclonal Antibody

Sample Type: Human HepG2, Antibody Dilution: 1.0 ug/ml. SMC1A is supported by BioGPS gene expression data to be expressed in HepG2.

SMC1A Rabbit Polyclonal Antibody

Sample Type: Human Jurkat, Antibody Dilution: 1.0 ug/ml. SMC1A is supported by BioGPS gene expression data to be expressed in Jurkat.

SMC1A Rabbit Polyclonal Antibody

Rabbit Anti-SMC1A Antibody, Catalog Number: orb576827, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

SMC1A Rabbit Polyclonal Antibody

WB Suggested Anti-SMC1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate. SMC1A is supported by BioGPS gene expression data to be expressed in HEK293T.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006297

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SMC1A Rabbit Polyclonal Antibody (orb576827)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry