Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SMARCD2 Rabbit Polyclonal Antibody

SKU: orb576578

Description

SMARCD2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SMARCD2. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human SMARCD2. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human SMARCD2
TargetSMARCD2
Protein SequenceSynthetic peptide located within the following region: STDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRH
Molecular Weight59 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

SGD2, Rsc6p, BAF60B, CRACD2, PRO2451

Similar Products

  • SMARCD2 Rabbit Polyclonal Antibody [orb574599]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SMARCD2 Rabbit Polyclonal Antibody [orb631321]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • SMARCD2 Rabbit Polyclonal Antibody [orb574600]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SMARCD2 Rabbit Polyclonal Antibody (HRP) [orb2129390]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    HRP

    100 μl
  • SMARCD2 Rabbit Polyclonal Antibody (FITC) [orb2129391]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    FITC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SMARCD2 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

SMARCD2 Rabbit Polyclonal Antibody

Sample Tissue: Human MDA-MB-435s Whole Cell, Antibody Dilution: 1 ug/ml.

SMARCD2 Rabbit Polyclonal Antibody

Positive control (+): 293T (2T), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/ml.

SMARCD2 Rabbit Polyclonal Antibody

Rabbit Anti-SMARCD2 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

SMARCD2 Rabbit Polyclonal Antibody

Rabbit Anti-SMARCD2 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 16 ug/ml, Magnification: 400X.

SMARCD2 Rabbit Polyclonal Antibody

WB Suggested Anti-SMARCD2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. SMARCD2 is supported by BioGPS gene expression data to be expressed in Jurkat.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003068

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SMARCD2 Rabbit Polyclonal Antibody (orb576578)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry