You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292624 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant SMAD3. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | SMAD3 (NP_005893, 120 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | VCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDL |
Tested applications | ELISA, IHC-P, PLA, WB |
Clone Number | 7F3 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_005893 |
Detection limit for recombinant GST tagged SMAD3 is approximately 0.1 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to SMAD3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Proximity Ligation Analysis of protein-protein interactions between MAPK8 and SMAD3. HeLa cells were stained with anti-MAPK8 rabbit purified polyclonal 1:1200 and anti-SMAD3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
SMAD3 monoclonal antibody (M02), clone 7F3. Western Blot analysis of SMAD3 expression in 293.
SMAD3 monoclonal antibody (M02), clone 7F3. Western Blot analysis of SMAD3 expression in HeLa.
SMAD3 monoclonal antibody (M02), clone 7F3. Western Blot analysis of SMAD3 expression in human colon.
SMAD3 monoclonal antibody (M02), clone 7F3. Western Blot analysis of SMAD3 expression in Jurkat.
SMAD3 monoclonal antibody (M02), clone 7F3. Western Blot analysis of SMAD3 expression in PC-12.
Western Blot analysis of SMAD3 expression in transfected 293T cell line by SMAD3 monoclonal antibody (M02), clone 7F3. Lane 1: SMAD3 transfected lysate (48 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.96 KDa).