Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SMAD3 Rabbit Polyclonal Antibody

SKU: orb592839

Description

SMAD3 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of SMAD3. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human SMAD3. This antibody reacts with Human, Mouse samples and is predicted to react with Canine, Guinea pig, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityCanine, Guinea pig, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SMAD3
TargetSMAD3
Protein SequenceSynthetic peptide located within the following region: FTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAIT
Molecular Weight48kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

LDS3, LDS1C, MADH3, JV15-2, HSPC193, HsT17436

Similar Products

  • Phospho-Smad3 (Ser423 + Ser425) Rabbit Polyclonal Antibody [orb6983]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-Smad3 (Thr179) Rabbit Polyclonal Antibody [orb313112]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Porcine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • Phospho-Smad3 (Ser213) Rabbit Polyclonal Antibody [orb106193]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Gallus, Guinea pig, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-Smad3 (Ser204) Rabbit Polyclonal Antibody [orb4684]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Smad3 Rabbit Polyclonal Antibody [orb6982]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SMAD3 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

SMAD3 Rabbit Polyclonal Antibody

Human Pancrease

SMAD3 Rabbit Polyclonal Antibody

Rabbit Anti-SMAD3 Antibody, Catalog Number: orb592839, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

SMAD3 Rabbit Polyclonal Antibody

WB Suggested Anti-SMAD3 Antibody Titration: 2.0 ug/ml, Positive Control: Human Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005893

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SMAD3 Rabbit Polyclonal Antibody (orb592839)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry