You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292627 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant SMAD1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2E9 |
Tested applications | ELISA, IF, IHC-P, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG1 Kappa |
Immunogen | SMAD1 (AAH01878.1, 1 a.a. ~ 465 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS |
NCBI | AAH01878.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged SMAD1 is approximately 1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to SMAD1 on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to SMAD1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
SMAD1 monoclonal antibody (M03), clone 2E9 Western Blot analysis of SMAD1 expression in HeLa.
SMAD1 monoclonal antibody (M03), clone 2E9. Western Blot analysis of SMAD1 expression in IMR-32.
SMAD1 monoclonal antibody (M03), clone 2E9. Western Blot analysis of SMAD1 expression in NIH/3T3.
SMAD1 monoclonal antibody (M03), clone 2E9. Western Blot analysis of SMAD1 expression in PC-12.
SMAD1 monoclonal antibody (M03), clone 2E9. Western Blot analysis of SMAD1 expression in Raw 264.7.
Western Blot detection against Immunogen (76.89 KDa).