SLURP1 monoclonal antibody (M06), clone 4D1

• Catalog Number: orb2290950
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SLURP1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: SLURP1 (NP_065160, 25 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: CYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSE
• Tested applications: ELISA, IP, WB
• Clone Number: 4D1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_065160

Detection limit for recombinant GST tagged SLURP1 is approximately 0.1 ng/ml as a capture antibody.

Immunoprecipitation of SLURP1 transfected lysate using anti-SLURP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SLURP1 MaxPab rabbit polyclonal antibody.

Western Blot analysis of SLURP1 expression in transfected 293T cell line by SLURP1 monoclonal antibody (M06), clone 4D1. Lane 1: SLURP1 transfected lysate(11.2 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (34.32 KDa).