SLIT1 Rabbit Polyclonal Antibody

• Catalog Number: orb584108
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLIT3
• Target: SLIT1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLIT1
• Protein Sequence: Synthetic peptide located within the following region: GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC
• UniProt ID: O75093
• MW: 168kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MEGF4, SLIL1, SLIT3, SLIT-1
• Research Area: Neuroscience, Signal Transduction, Stem Cell & Dev
• Note: For research use only
• NCBI: NP_003052

Immunohistochemistry with SLIT1 GFP/ WT mouse gut tissue at an antibody concentration of 2.5 ug/ml using anti-SLIT1 antibody (orb584108).

WB Suggested Anti-SLIT1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Stomach.