SLC6A5 Rabbit Polyclonal Antibody

• Catalog Number: orb325099
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC6A5
• Target: SLC6A5
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC6A5
• Protein Sequence: Synthetic peptide located within the following region: LIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPE
• UniProt ID: Q9Y345
• MW: 87kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti GLYT2 antibody, anti NET1 antibody, anti GLYT
• Research Area: Cell Biology, Neuroscience
• Note: For research use only
• NCBI: NP_004202

WB Suggested Anti-SLC6A5 Antibody Titration: 0.2-1 ug/mL, Positive Control: PANC1 cell lysate, SLC6A5 is supported by BioGPS gene expression data to be expressed in PANC1.