SLC6A14 Rabbit Polyclonal Antibody

SKU: orb578984

Description

Rabbit polyclonal antibody to SLC6A14

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC6A14
• Target: SLC6A14
• Protein Sequence: Synthetic peptide located within the following region: VFAGFAIFSILGHMAHISGKEVSQVVKSGFDLAFIAYPEALAQLPGGPFW
• Molecular Weight: 72kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

BMIQ11

Positive control (+): HepG2 (HG), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

WB Suggested Anti-SLC6A14 Antibody Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.

Quick Database Links

Gene Symbol

SLC6A14

UniProt

Q9UN76

RefSeq (Protein):NP_009162