SLC4A3 Rabbit Polyclonal Antibody

• Catalog Number: orb324987
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC4A3
• Target: SLC4A3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human SLC4A3
• Protein Sequence: Synthetic peptide located within the following region: DDLGKTLAVSRFGDLISKPPAWDPEKPSRSYSERDFEFHRHTSHHTHHPL
• UniProt ID: P48751
• MW: 56kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: AE3, SLC2C, CAE3/BAE3
• Note: For research use only
• NCBI: NP_005061.2

Sample Tissue: Human Esophagus Tumor, Antibody Dilution: 1 ug/mL.

Positive control (+): Rat Kidney (R-KI), Negative control (-): Rat Intestine (R-IN), Antibody concentration: 1 ug/mL.