You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
SLC43A1 Rabbit Polyclonal Antibody
Catalog Number: orb578964
| Catalog Number | orb578964 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SLC43A1 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Mouse, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC43A1 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 61kDa |
| Target | SLC43A1 |
| UniProt ID | O75387 |
| Protein Sequence | Synthetic peptide located within the following region: AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLI |
| NCBI | NP_003618 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | LAT3, PB39, POV1, R00504 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
WB Suggested Anti-SLC43A1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.
- Item 1 of 3
- Item 1 of 2
Anti-SLC43A1 Antibody [orb214792]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl - Item 1 of 1
SLC43A1 Rabbit Polyclonal Antibody (FITC) [orb2120127]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
FITC
100 μl
