SLC38A9 Rabbit Polyclonal Antibody

• Catalog Number: orb325844
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC38A9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC38A9
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 64kDa
• Target: SLC38A9
• UniProt ID: Q8NBW4
• Protein Sequence: Synthetic peptide located within the following region: VLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNS
• NCBI: NP_775785
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ46104 antibody, anti MGC120544 antibody, a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-SLC38A9 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.

WB Suggested Anti-SLC38A9 Antibody Titration: 0.2-1 ug/mL, Positive Control: Lane 1: HepG2, Lane 2: HeLa, Lane 3: HEK293T.