SLC36A1 antibody

Catalog Number: orb585925

Catalog Number	orb585925
Category	Antibodies
Description	Rabbit polyclonal antibody to SLC36A1
Species/Host	Rabbit
Clonality	Polyclonal
Tested applications	WB
Predicted Reactivity	Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
Reactivity	Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat
Concentration	0.5 mg/ml
Form/Appearance	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
MW	53kDa
Target	SLC36A1
UniProt ID	Q7Z2H8
Protein Sequence	Synthetic peptide located within the following region: STQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWFQ
NCBI	NP_510968
Storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Alternative names	Dct1, PAT1, LYAAT1, TRAMD3 Read more...
Note	For research use only
Expiration Date	12 months from date of receipt.