SLC35C1 Rabbit Polyclonal Antibody

• Catalog Number: orb325115
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC35C1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC35C1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40 kDa
• Target: SLC35C1
• UniProt ID: Q96A29
• Protein Sequence: Synthetic peptide located within the following region: TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG
• NCBI: NP_060859
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ11320 antibody, anti FLJ14841 antibody, an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Positive control (+): Human Liver (LI), Negative control (-): HepG2 Cell Lysate (HG), Antibody concentration: 3 ug/mL.

WB Suggested Anti-SLC35C1 Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate.