SLC30A8 Rabbit Polyclonal Antibody

SKU: orb333721

Description

SLC30A8 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SLC30A8. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human SLC30A8. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC30A8
• Target: SLC30A8
• Protein Sequence: Synthetic peptide located within the following region: LLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTG
• Molecular Weight: 41kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti SLC30A8 antibody, anti solute carrier family 30 (zinc transporter), member 8 antibody, anti Solute carrier family 30 member 8 antibody, anti Zinc transporter 8 antibody, anti zinc transporter ZnT-8 antibody, anti ZnT-8 antibody, anti ZNT8 antibody, anti ZNT8_HUMAN antibody

Quick Database Links

Gene Symbol

SLC30A8

UniProt

Q8IWU4

RefSeq (Protein):NP_776250