SLC2A8 Rabbit Polyclonal Antibody

• Catalog Number: orb578994
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC2A8
• Target: SLC2A8
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC2A8
• Protein Sequence: Synthetic peptide located within the following region: VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAW
• UniProt ID: Q9NY64
• MW: 51kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GLUT8, GLUTX1
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_055395

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): HeLa Cell Lysate (HL), Antibody concentration: 3 ug/ml.

WB Suggested Anti-SLC2A8 Antibody Titration: 0.2-1 ug/ml, Positive Control: NCI-H226 cell lysate.