SLC25A46 Rabbit Polyclonal Antibody

• Catalog Number: orb579049
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC25A46
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A46
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46kDa
• Target: SLC25A46
• UniProt ID: Q96AG3
• Protein Sequence: Synthetic peptide located within the following region: RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEP
• NCBI: NP_620128
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HMSN6B
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-SLC25A46 Antibody Titration: 5.0 ug/ml, Positive Control: Jurkat cell lysate. SLC25A46 is supported by BioGPS gene expression data to be expressed in Jurkat.