SLC22A2 Antibody

• Catalog Number: orb251577
• Category: Antibodies
• Description: SLC22A2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 62581 MW
• UniProt ID: O15244
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Solute carrier family 22 member 2;Organic cation t
• Note: For research use only
• Application notes: WB: The detection limit for SLC22A2 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

IHC(P) analysis of Mouse Kidney Tissue using Anti-SLC22A2 Picoband antibody.

IHC(P) analysis of Rat Kidney Tissue using Anti-SLC22A2 Picoband antibody.

Western blot analysis using Anti-SLC22A2 Picoband antibody.Lane 1:Rat Brain Tissue;2:Mouse Brain Tissue.