You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
SLC22A18 Rabbit Polyclonal Antibody
Catalog Number: orb325094
| Catalog Number | orb325094 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SLC22A18 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A18 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 45kDa |
| Target | SLC22A18 |
| UniProt ID | Q96BI1 |
| Protein Sequence | Synthetic peptide located within the following region: AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG |
| NCBI | NP_002546 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti BWR1A antibody, anti BWSCR1A antibody, anti D Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.
WB Suggested Anti-SLC22A18 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, SLC22A18 is supported by BioGPS gene expression data to be expressed in HepG2.
- Item 1 of 2
- Item 1 of 2
SLC22A18 Antibody [orb631236]
ELISA, IP, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg - Item 1 of 1
- Item 1 of 1
