SLC22A16 Rabbit Polyclonal Antibody

• Catalog Number: orb330361
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC22A16
• Target: SLC22A16
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A16
• Protein Sequence: Synthetic peptide located within the following region: CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR
• UniProt ID: Q96RU0
• MW: 63kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CT2 antibody, anti FLIPT2 antibody, anti OCT6
• Research Area: Cell Biology, Stem Cell & Developmental Biology
• Note: For research use only
• NCBI: NP_149116

Human kidney

WB Suggested Anti-SLC22A16 Antibody Titration: 2.5 ug/mL, Positive Control: HepG2 cell lysate.