SLC1A2 Rabbit Polyclonal Antibody

SKU: orb329749

Description

Rabbit polyclonal antibody to SLC1A2

Research Area

Epigenetics & Chromatin, Molecular Biology, Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC1A2
• Target: SLC1A2
• Protein Sequence: Synthetic peptide located within the following region: PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK
• Molecular Weight: 62kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti EAAT2 antibody, anti GLT-1 antibody

Anti-SLC1A2 / EAAT2 antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. SLC1A2 Antibody orb329749 concentration 5 ug/mL.

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: Fetal Brain lysates, Antibody Dilution: 1.0 ug/mL.

Sample Type: Fetal Brain, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/Lane, Gel Concentration: 0.12.

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

Rabbit Anti-SLC1A2 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-SLC1A2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human brain.

Quick Database Links

Gene Symbol

SLC1A2

UniProt

P43004

RefSeq (Protein):NP_004162