SLC18A2 Rabbit Polyclonal Antibody

• Catalog Number: orb578959
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC18A2
• Target: SLC18A2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC18A2
• Protein Sequence: Synthetic peptide located within the following region: NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT
• UniProt ID: Q05940
• MW: 56kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: SVAT, SVMT, VAT2, VMAT2, PKDYS2
• Research Area: Cell Biology, Neuroscience
• Note: For research use only
• NCBI: NP_003045

SLC18A2 (VMAT2) in human brain (cortex) was detected using HRP/DAB brown color stain.

WB Suggested Anti-SLC18A2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.