SLC13A3 Rabbit Polyclonal Antibody

• Catalog Number: orb330179
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC13A3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC13A3
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 61kDa
• Target: SLC13A3
• UniProt ID: Q8WWT9
• Protein Sequence: Synthetic peptide located within the following region: GLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMF
• NCBI: NP_001011554
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti NADC3 antibody, anti SDCT2 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): HepG2 (HG), Negative control (-): 293T (2T), Antibody concentration: 2.5 ug/mL.

Rabbit Anti-SLC13A3 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-SLC13A3 Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate.