SLC11A2 monoclonal antibody (M01), clone 4C6

• Catalog Number: orb2292492
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SLC11A2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4C6
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: SLC11A2 (NP_000608, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF
• NCBI: NP_000608
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged SLC11A2 is 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to SLC11A2 on formalin-fixed paraffin-embedded human endometrium cancer. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (32.89 KDa).