You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292492 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant SLC11A2. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | SLC11A2 (NP_000608, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF |
Tested applications | ELISA, IHC-P, WB |
Clone Number | 4C6 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_000608 |
Detection limit for recombinant GST tagged SLC11A2 is 0.03 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to SLC11A2 on formalin-fixed paraffin-embedded human endometrium cancer. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (32.89 KDa).