SKP2 Rabbit Polyclonal Antibody

• Catalog Number: orb573605
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SKP2
• Target: SKP2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SKP2
• Protein Sequence: Synthetic peptide located within the following region: TLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL
• UniProt ID: Q13309
• MW: 23kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: p45, FBL1, FLB1, FBXL1
• Research Area: Cancer Biology, Cell Biology, Epigenetics & Chroma
• Note: For research use only

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Colorectal Tumor lysates, Antibody dilution: 1.0 ug/ml.