SIM2 Rabbit Polyclonal Antibody

SKU: orb329992

Description

Rabbit polyclonal antibody to SIM2

Research Area

Epigenetics & Chromatin, Neuroscience, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SIM2
• Target: SIM2
• Protein Sequence: Synthetic peptide located within the following region: MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYL
• Molecular Weight: 73 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti MGC119447 antibody, anti SIM antibody, anti bHLHe15 antibody, anti HMC13F06 antibody, anti HMC29C01 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 73 kDa isoform is identified.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-SIM2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human kidney.

Quick Database Links

Gene Symbol

SIM2

UniProt

Q14190

RefSeq (Protein):NP_005060