SIM2 Rabbit Polyclonal Antibody

• Catalog Number: orb329992
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SIM2
• Target: SIM2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SIM2
• Protein Sequence: Synthetic peptide located within the following region: MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYL
• UniProt ID: Q14190
• MW: 73 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti MGC119447 antibody, anti SIM antibody, anti b
• Research Area: Epigenetics & Chromatin, Neuroscience, Stem Cell &
• Note: For research use only
• NCBI: NP_005060

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 73 kDa isoform is identified.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-SIM2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human kidney.