SIL1 Rabbit Polyclonal Antibody

• Catalog Number: orb579311
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SIL1
• Target: SIL1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SIL1
• Protein Sequence: Synthetic peptide located within the following region: KLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCR
• UniProt ID: Q9H173
• MW: 49kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BAP, MSS, ULG5
• Research Area: Cell Biology, Epigenetics & Chromatin, Signal Tran
• Note: For research use only
• NCBI: NP_001032722
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-SIL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate. SIL1 is supported by BioGPS gene expression data to be expressed in HeLa.

WB Suggested Anti-SIL1 antibody Titration: 1 ug/ml, Sample Type: Human heart.