SNF1LK Rabbit Polyclonal Antibody

• Catalog Number: orb579612
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SNF1LK
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNF1LK
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 85 kDa
• Target: SIK1
• UniProt ID: P57059
• Protein Sequence: Synthetic peptide located within the following region: MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK
• NCBI: NP_775490
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MSK, SIK, DEE30, SIK-1, SIK1B, SNF1LK
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein is phosphorylated.

Positive control (+): Hela (HL), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml.

Human Stomach

WB Suggested Anti-SNF1LK Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.