SIGLEC6 Rabbit Polyclonal Antibody

• Catalog Number: orb330211
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SIGLEC6
• Target: SIGLEC6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Porcine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SIGLEC6
• Protein Sequence: Synthetic peptide located within the following region: VPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRL
• UniProt ID: O43699
• MW: 47kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CD33L antibody, anti CD33L1 antibody, anti CD
• Research Area: Cell Biology, Disease Biomarkers, Signal Transduct
• Note: For research use only
• NCBI: NP_001236

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-SIGLEC6 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Jurkat cell lysate.