SHROOM2 Rabbit Polyclonal Antibody

• Catalog Number: orb575361
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SHROOM2
• Target: SHROOM2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SHROOM2
• Protein Sequence: Synthetic peptide located within the following region: CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM
• UniProt ID: Q13796
• MW: 176 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: APXL, HSAPXL
• Note: For research use only
• NCBI: NP_001640

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide is present in isoforms of 176 kDa, 170 kDa, and 51 kDa. This protein has multiple phosphorylation sites.

WB Suggested Anti-SHROOM2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Lung.