SHROOM2 Rabbit Polyclonal Antibody

SKU: orb575361

Description

Rabbit polyclonal antibody to SHROOM2

Research Area

Cell Biology, Pharmacology & Drug Discovery

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SHROOM2
• Target: SHROOM2
• Protein Sequence: Synthetic peptide located within the following region: CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM
• Molecular Weight: 176 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

APXL, HSAPXL

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide is present in isoforms of 176 kDa, 170 kDa, and 51 kDa. This protein has multiple phosphorylation sites.

WB Suggested Anti-SHROOM2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Lung.

Quick Database Links

Gene Symbol

SHROOM2

UniProt

Q13796

RefSeq (Protein):NP_001640